PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G143400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 290aa    MW: 31959.8 Da    PI: 6.9095
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G143400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161462148
                       TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                       rg+W++eEd  l+++v+++G+g +W + +++ g++R++k+c++rw++yl
  Aqcoe7G143400.1.p 14 RGPWSPEEDITLKNYVERYGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                       89*********************************************97 PP

2Myb_DNA-binding39.81.1e-1269111246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        g +T+eEd ++  + k  G++ W+ Ia+ +  gRt++++k++w++
  Aqcoe7G143400.1.p  69 GGFTEEEDTIICTLYKNIGSR-WSVIASQLK-GRTDNDVKNYWNT 111
                        569******************.********9.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.482962IPR017930Myb domain
SuperFamilySSF466891.95E-2711109IPR009057Homeodomain-like
SMARTSM007171.3E-111364IPR001005SANT/Myb domain
PfamPF002491.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-241569IPR009057Homeodomain-like
CDDcd001675.12E-91662No hitNo description
PROSITE profilePS5129420.59863117IPR017930Myb domain
SMARTSM007174.3E-1167115IPR001005SANT/Myb domain
PfamPF002493.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2370117IPR009057Homeodomain-like
CDDcd001671.70E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDITLKNYVE RYGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPDIKHGG FTEEEDTIIC TLYKNIGSRW SVIASQLKGR TDNDVKNYWN TKLKKKILAG  120
KINLTGHNNI VPSNNHIQPN SSSSPAMLNV SPNYLNHNFT TMPMSMDVNV KQEVSSSGMV  180
SDVLIQYPLP ELMESLEFGS SSNNNQIISS SPEVSSYSVP SFDSNFSLWW PGNGIADDDR  240
FLMDFGFGMS YDLPSGAGAS SIGNYSTNDS LLSNTSDTIP QGLYQSITN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267089.18e-94PREDICTED: transcription repressor MYB6-like
TrEMBLA0A061GIZ29e-89A0A061GIZ2_THECC; Myb domain protein 84, putative
STRINGPOPTR_0006s25060.16e-81(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-75myb domain protein 36